PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AS_2EE7C2628.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 229aa    MW: 25495.4 Da    PI: 10.2901
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AS_2EE7C2628.11genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.6e-081331648
                            HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            v+ +G g+W++ +   g+ R++k+c++rw +yl
  Traes_7AS_2EE7C2628.11  1 VRAHGEGCWRSLPGAAGLLRCGKSCRLRWINYL 33
                            788**************99************97 PP

2Myb_DNA-binding56.37.3e-183983147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                            rg++T +Ed+l+v+++ +lG++ W++Ia++++ gRt++++k++w+++
  Traes_7AS_2EE7C2628.11 39 RGNFTRDEDDLIVKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 83
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001670.00281133No hitNo description
PROSITE profilePS512949.663133IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-13140IPR009057Homeodomain-like
PfamPF002491.1E-5133IPR001005SANT/Myb domain
SuperFamilySSF466892.8E-222089IPR009057Homeodomain-like
PROSITE profilePS5129428.153488IPR017930Myb domain
SMARTSM007178.6E-173886IPR001005SANT/Myb domain
PfamPF002493.6E-163983IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-274188IPR009057Homeodomain-like
CDDcd001673.33E-134184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
VRAHGEGCWR SLPGAAGLLR CGKSCRLRWI NYLRPDLKRG NFTRDEDDLI VKLHSLLGNK  60
WSLIAARLPG RTDNEIKNYW NTHIRRKLLG RGIDPVTHRP LTHAASATTV SFLHPAEPPK  120
TQPATELSKP PRCPDLNLDL CISLPFQQEE ERPPARACAK PVKMEQLQQG GGGLCFRXVK  180
MEQLQQGGGG LCFRCSILRV RGAATECSCG SNFLGLRAGM LDFRGLRMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-21208840108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3584050.0AK358405.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1075P05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695776.16e-98PREDICTED: myb-related protein Zm38-like
SwissprotP200257e-90MYB38_MAIZE; Myb-related protein Zm38
TrEMBLA0A096UV751e-168A0A096UV75_WHEAT; Uncharacterized protein
STRINGBGIOSGA026527-PA3e-96(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.15e-70myb domain protein 7
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]